Protein Info for ABIE40_RS21550 in Rhizobium sp. OAE497

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF00561: Abhydrolase_1" amino acids 24 to 250 (227 residues), 105.9 bits, see alignment E=5.8e-34 PF00975: Thioesterase" amino acids 24 to 136 (113 residues), 30.1 bits, see alignment E=1.1e-10 PF12697: Abhydrolase_6" amino acids 25 to 255 (231 residues), 74.8 bits, see alignment E=3.4e-24 PF12146: Hydrolase_4" amino acids 25 to 248 (224 residues), 69.2 bits, see alignment E=7e-23

Best Hits

KEGG orthology group: None (inferred from 94% identity to rlt:Rleg2_5507)

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>ABIE40_RS21550 alpha/beta hydrolase (Rhizobium sp. OAE497)
MAEAQRHTVGDVTLNYRIDGSGDPLVCIHGVGSYLEAWSGVVERLKDSFTILTFDLRGHG
QSSRVKGRYEIDDFVNEALALADKAGFTSFNLAGFSLGGLIAQRLALTHLDRLRKLVLLS
TVAGRTPEERTRVLERLAALRAGTPADHHNASLSRWLSEEFQAANPEVIARLRQRDAEND
PECYAAAYRVLAETDFGGFLDQIRCPTLIATGEDDAGSNPRMARYMHERIPGSTLSILPG
LRHSILIEAPETVANLMRGFLAAKETNHG