Protein Info for ABIE40_RS21195 in Rhizobium sp. OAE497

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 transmembrane" amino acids 15 to 42 (28 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 163 to 188 (26 residues), see Phobius details amino acids 194 to 212 (19 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 118 (105 residues), 67.9 bits, see alignment E=4.6e-23 PF00528: BPD_transp_1" amino acids 30 to 223 (194 residues), 60.9 bits, see alignment E=6.8e-21

Best Hits

Swiss-Prot: 39% identical to NOCM_AGRFC: Nopaline transport system permease protein NocM (nocM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 58% identity to rva:Rvan_2182)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>ABIE40_RS21195 ABC transporter permease subunit (Rhizobium sp. OAE497)
MIDLDVFQQYGGRLFSGLLVTIELTVISITLGAVLAALLTWARLSGPKAVRAAAFAYSYA
VRGTPLLAQVFLVYYGSGQFRPELQALGLWQLFREPQFCVLLTFSLNTAAYQSEIFRGAV
LAVPRGQMEAAKALALRPFLATFLVVVPQAIRHGLRGFGNEVVLVLKGSAVASVVTVYDL
LGATRFAFQRTYDFQLYIAAAIVYIIIVELLRRGWNHLEARFRLKAAR