Protein Info for ABIE40_RS21075 in Rhizobium sp. OAE497

Annotation: biotin synthase BioB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00433: biotin synthase
  • amino acids 26 to 321 (296 residues), 389 bits, E=6.9e-121
• PF04055: Radical_SAM
  • amino acids 60 to 217 (158 residues), 87.5 bits, E=1.2e-28
• PF06968: BATS
  • amino acids 231 to 321 (91 residues), 92.4 bits, E=1.6e-30

Best Hits

Swiss-Prot: 80% identical to BIOB_OCHA4: Biotin synthase (bioB) from Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / JCM 21032 / NBRC 15819 / NCTC 12168)

KEGG orthology group: K01012, biotin synthetase [EC: 2.8.1.6] (inferred from 80% identity to oan:Oant_2823)

MetaCyc: 58% identical to biotin synthase (Escherichia coli K-12 substr. MG1655)
Biotin synthase. [EC: 2.8.1.6]

Predicted SEED Role

"Biotin synthase (EC 2.8.1.6)" in subsystem Biotin biosynthesis (EC 2.8.1.6)

MetaCyc Pathways

• biotin biosynthesis I (13/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis II (4/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.6

Protein Sequence (332 amino acids)

>ABIE40_RS21075 biotin synthase BioB (Rhizobium sp. OAE497)
MLKTEVAKAAERGSAESRWTLDSARELYDLPFNDLLYRSHGIHRANFDPNEVQLSKLLNI
KTGGCPEDCGYCSQSAHASGLVASKLMKLDDVMSEARKAKESGATRYCMGAAWRSPKARD
EAAIVAMVKGVKSLGLETCMTLGMLSSEQAETFADAGLDYYNHNVDTSERFYPEVITTRS
FSDRLETLAHVREAGIKVCSGGILGMGETVDDRIDMLVTLANLPEPPESVPINLLIPMPG
TRMANVDPVDPIEFIRIIALARLMMPASSVRLTAGRTAMSDEMQALCFFAGANSIFIGDT
LLTAANPGNDRDSNLLARLGMTATSLEIPGEC