Protein Info for ABIE40_RS21000 in Rhizobium sp. OAE497

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 16 to 43 (28 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 86 to 102 (17 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 186 to 205 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 10 to 107 (98 residues), 101.7 bits, see alignment E=1.3e-33 PF00528: BPD_transp_1" amino acids 30 to 212 (183 residues), 72.8 bits, see alignment E=1.6e-24

Best Hits

Swiss-Prot: 45% identical to YECS_ECOL6: L-cystine transport system permease protein YecS (yecS) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 80% identity to pfl:PFL_2359)

MetaCyc: 45% identical to cystine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-290 [EC: 7.4.2.12]; 7.4.2.12 [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]; 7.4.2.- [EC: 7.4.2.12]

Predicted SEED Role

"Putative transport system permease protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>ABIE40_RS21000 amino acid ABC transporter permease (Rhizobium sp. OAE497)
MDLALMQRVLPFFLEAAWVTVQISCLSLLLGFLVAIALVALRLSDFLAVRCLSRLYVSVF
RGTPCLVQLFVIYFGGPQMGLELDPFVAGVIGLGLNIAAYMAESIRGAIENVDRGQSEAA
RSIGFGRAATLRLVVLPQAARLMIRPLGVNAVGLIKGSALVSSISVVELTYTAQRFISST
YKPFEIFSVSAVLYIVMVYAVRLVVDRLDQRFAAR