Protein Info for ABIE40_RS20350 in Rhizobium sp. OAE497

Annotation: imidazolonepropionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 283 to 303 (21 residues), see Phobius details TIGR01224: imidazolonepropionase" amino acids 35 to 412 (378 residues), 439.2 bits, see alignment E=5.8e-136 PF01979: Amidohydro_1" amino acids 72 to 390 (319 residues), 77.9 bits, see alignment E=8.8e-26 PF07969: Amidohydro_3" amino acids 134 to 390 (257 residues), 65.7 bits, see alignment E=6e-22

Best Hits

Swiss-Prot: 83% identical to HUTI_CHESB: Imidazolonepropionase (hutI) from Chelativorans sp. (strain BNC1)

KEGG orthology group: K01468, imidazolonepropionase [EC: 3.5.2.7] (inferred from 81% identity to rlt:Rleg2_5926)

MetaCyc: 52% identical to imidazolonepropionase (Pseudomonas fluorescens)
Imidazolonepropionase. [EC: 3.5.2.7]

Predicted SEED Role

"Imidazolonepropionase (EC 3.5.2.7)" in subsystem Histidine Degradation (EC 3.5.2.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>ABIE40_RS20350 imidazolonepropionase (Rhizobium sp. OAE497)
MTGDNLHSEMERPSLWRNARLATLNPAQSGLGIIERGAIVTENGRITYAGPESELPVSMI
ERAEITDLEGRWVTPGLVDCHTHIVYGGNRAREFEMRLEGATYEEVARAGGGIVSSVKAT
NALSVDGLVQASIRRLDTLLSEGVTTIEIKSGYGLTSDGELKMLEAARALGTIRPVRVKT
SYLGAHATPAHYKGRNGDYISEVVLPTLDEAHKRGLADAVDGFCEGIAFSTEEIARVFDR
AKALGLPVKLHAEQLSNLGGAKLAAGYGALSADHLEYLDDEGIAAMAAAGTVAVLLPGAF
YAINEKQKPPVKALRAAGVPIAIATDCNPGTSPLTSLLLTMNMSATLFGLTVEECIAGAT
REGARALGLLGETGTLETGRSADLAIWDIESPAELVYRIGFNPLHARVFKGERIDR