Protein Info for ABIE40_RS20075 in Rhizobium sp. OAE497

Annotation: extracellular solute-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF01547: SBP_bac_1" amino acids 32 to 313 (282 residues), 74.1 bits, see alignment E=4.1e-24 PF13531: SBP_bac_11" amino acids 41 to 313 (273 residues), 26.4 bits, see alignment E=1.1e-09 PF13416: SBP_bac_8" amino acids 46 to 316 (271 residues), 89.5 bits, see alignment E=6.6e-29 PF13343: SBP_bac_6" amino acids 87 to 352 (266 residues), 47.3 bits, see alignment E=3.7e-16

Best Hits

KEGG orthology group: None (inferred from 76% identity to pgv:SL003B_3194)

Predicted SEED Role

"ABC transporter periplasmic binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (377 amino acids)

>ABIE40_RS20075 extracellular solute-binding protein (Rhizobium sp. OAE497)
MKRLTYAAFAVALAVLPVKADELTVATAGDQNMVDYINQYLGPLFEKTYPGNTVRAVGTG
PGDAGSQKILERFDAQQAANTANWDIDVAVVHEKFAGPMVQKGYLEKYRSAIDTGKLVSR
DNAKNALGSDVDGYVMPMFNSQTAIAYNPTLVPNPPKSYTELAAWAKEHPKQFGYNGIKG
GASGVSFVMGWIYAFGGGDANNLMTGPFKQDETAKWGDAFKSLADFTKNATLTPGNAGTL
DLLSRGEIAMGPVWVDMFYSWQANGQLPPELKLVLPAPGMPGQPMHYVVPAKASHKDLAE
KFIALATSPEVQADGIVKKFNWYPGIDAQFVKPKLDDATWNKLFVDITPDDLATKGKPFP
IAQYNTAILEAYEQSVK