Protein Info for ABIE40_RS20045 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 transmembrane" amino acids 15 to 36 (22 residues), see Phobius details amino acids 74 to 100 (27 residues), see Phobius details amino acids 117 to 136 (20 residues), see Phobius details amino acids 164 to 188 (25 residues), see Phobius details amino acids 218 to 244 (27 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 105 to 300 (196 residues), 52 bits, see alignment E=3.7e-18

Best Hits

KEGG orthology group: K02025, multiple sugar transport system permease protein (inferred from 92% identity to ret:RHE_PB00114)

Predicted SEED Role

"binding-protein-dependent transport systems inner membrane component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>ABIE40_RS20045 sugar ABC transporter permease (Rhizobium sp. OAE497)
MAVSGRQFGDSWRSYSLYLIPGLIGFVLIVLIPQLANLGLSFTAWKGVGTPRPVGLQNYS
RLLTDDQFWGSMYHTLLFIVSMTVIPVCIGLVLAAVLFDYVRDQFGDWVSSFFRAGFYLP
QILPVTVAGVLWGWILNPVGVINITLKAIGLDGLAQNWIGDATYALAAVSLVIVWIQVGY
CLVVFMAGLSRIDPSLYEAAELDGAHWWSRFVTITIPLLAPEIFVVVLTTLIAALKVFAP
IFVITAGGPDNATLVPSYLTYYHFFTTQRVGYAAAIAVVQTILTIALAVIFLRFQSRQEP
KD