Protein Info for ABIE40_RS19855 in Rhizobium sp. OAE497

Annotation: NADP-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF16884: ADH_N_2
  • amino acids 10 to 114 (105 residues), 138.3 bits, E=1.4e-44
• PF00107: ADH_zinc_N
  • amino acids 160 to 286 (127 residues), 61.5 bits, E=1.3e-20
• PF13602: ADH_zinc_N_2
  • amino acids 193 to 336 (144 residues), 49.6 bits, E=1.3e-16

Best Hits

Swiss-Prot: 60% identical to CURA_ECOLI: NADPH-dependent curcumin reductase (curA) from Escherichia coli (strain K12)

KEGG orthology group: K07119, (no description) (inferred from 75% identity to ara:Arad_8165)

MetaCyc: 60% identical to NADPH-dependent curcumin/dihydrocurcumin reductase (Escherichia coli K-12 substr. MG1655)
RXN0-6676; RXN0-6677

Predicted SEED Role

"Putative oxidoreductase YncB"

MetaCyc Pathways

• curcumin degradation (2/2 steps found)

Protein Sequence (340 amino acids)

>ABIE40_RS19855 NADP-dependent oxidoreductase (Rhizobium sp. OAE497)
MPEPVENVKITLASRPSGAPVPDNFRLERAAAPEPGEGELLLQILYLSLDPYMRGRMDDA
KSYSAPVALGGVMEGGTVARVVSSRNSNFAPGDIVLSHSGWQLYATSNGDGLRKLDPTQA
PVTTALGVLGMPGFTAYAGLRNIGKPKPGETVVVAAASGAVGSVVGQIAKLRGARAVGIA
GGPEKCAFIRDELGFDVAIDHHTKDFGVQLAAACPDGIDVYFENVGGAVAETVFPLLNDF
ARIPVCGLIAHYNNEPAEGLDRLPGFMRAVLRKSLTVRGFIQREFVDQRPDFLAEASAWI
ADGRLKFREDIVDGLENAPEAFIGLLQGKNFGKLIIRVSE