Protein Info for ABIE40_RS19140 in Rhizobium sp. OAE497

Annotation: RsmB/NOP family class I SAM-dependent RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01029: NusB
  • amino acids 29 to 154 (126 residues), 82.7 bits, E=8.2e-27
• PF13847: Methyltransf_31
  • amino acids 265 to 389 (125 residues), 31.9 bits, E=2.8e-11
• PF01189: Methyltr_RsmB-F
  • amino acids 266 to 457 (192 residues), 142.1 bits, E=4.7e-45
• PF13649: Methyltransf_25
  • amino acids 268 to 334 (67 residues), 28.8 bits, E=4.1e-10

Best Hits

KEGG orthology group: K03500, ribosomal RNA small subunit methyltransferase B [EC: 2.1.1.-] (inferred from 80% identity to rlt:Rleg2_3917)

Predicted SEED Role

"16S rRNA m(5)C 967 methyltransferase (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (461 amino acids)

>ABIE40_RS19140 RsmB/NOP family class I SAM-dependent RNA methyltransferase (Rhizobium sp. OAE497)
MVLNSNGKKPANKNSNKPGERPPAKPGLQARSAAAKILAAVVDKKLPLDGALDHEHGNPA
YKALGESDRALVRAILNSALRHLPRIDAAIASLLDCPLPDGARALHHVLVVGAAQILYLD
VPDHSAVDLAVEQANNDPRNRRFAKLVNAILRRLGREKEAVLASVADVPAMPDWFLARLS
KAYGRQAALAISDSQLEPAAIDLTVKADAAAWAERLNGAVLPTGGVRLAAFDGSIPSLEG
FEDGAWWVQDAAASIPAKLFGDLTGKRVADLCAAPGGKTAQLILAGGKVTAIDQSENRLK
RLRSNLARLGLEAETLVTDLTKFQPEEGFDAILLDAPCSSTGTTRRHPDVLWTKGPEEIE
KLAGVQERLLRHALAFLKPDGVIVFSNCSLDPTEGEDVIARVLADVPGIARVPIEAASWP
GLEQAISPLGDFRTTPVMLPMPDGIASGLDGFYAAVLRRVA