Protein Info for ABIE40_RS18975 in Rhizobium sp. OAE497

Annotation: S41 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 52 to 367 (316 residues), 330.6 bits, see alignment E=5.1e-103 PF00595: PDZ" amino acids 97 to 166 (70 residues), 33.5 bits, see alignment E=9e-12 PF13180: PDZ_2" amino acids 99 to 178 (80 residues), 46.3 bits, see alignment E=8.8e-16 PF17820: PDZ_6" amino acids 118 to 168 (51 residues), 39.2 bits, see alignment 1e-13 PF03572: Peptidase_S41" amino acids 196 to 363 (168 residues), 189 bits, see alignment E=9.4e-60

Best Hits

Swiss-Prot: 71% identical to CTPA_BARBK: Carboxy-terminal-processing protease (ctpA) from Bartonella bacilliformis (strain ATCC 35685 / NCTC 12138 / KC583)

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 96% identity to rlg:Rleg_4209)

Predicted SEED Role

"Carboxyl-terminal protease (EC 3.4.21.102)" (EC 3.4.21.102)

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (440 amino acids)

>ABIE40_RS18975 S41 family peptidase (Rhizobium sp. OAE497)
MIRRASLVLVGALMGATAMSVIYSAGVPAEAAGASTYKELSVFGDVFERVRAQYVTPPDE
NKLVENAINGMLSSLDPHSSYMNAKDAEDMSTQTKGEFGGLGIEVTMEDELVKVITPIDD
TPAAKAGVLAGDYISEIDGQSVRGLKLEDAVEKMRGAINTPIKLTLIRKGADKPIELTIV
RDVVAVQAVKSRVEDDVGYLRVISFTEKTYPDLEKAITKIKATVPADKLKGYVLDLRLNP
GGLLDQAIKVSDALLERGEVVSTRGRNPDETRRWNAGPGDLTDGKPVIVLINGGSASASE
IVAGALQDLRRATVLGTRSFGKGSVQTIIPLGENGALRLTTALYYTPSGRSIQGTGITPD
IKVDEPLPDDLKGKMVTEGESSLRGHIKGQSETDEGSGSVAYVPPDPKDDVQLNYALDLL
RGKKTDPAFPPNPEKAVSAK