Protein Info for ABIE40_RS18065 in Rhizobium sp. OAE497

Annotation: hydroxymethylbilane synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01379: Porphobil_deam
  • amino acids 6 to 215 (210 residues), 254.3 bits, E=8.4e-80
• TIGR00212: hydroxymethylbilane synthase
  • amino acids 7 to 298 (292 residues), 334.4 bits, E=2.5e-104
• PF03900: Porphobil_deamC
  • amino acids 229 to 295 (67 residues), 53.6 bits, E=2.3e-18

Best Hits

Swiss-Prot: 77% identical to HEM3_AGRFC: Porphobilinogen deaminase (hemC) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: K01749, hydroxymethylbilane synthase [EC: 2.5.1.61] (inferred from 89% identity to rec:RHECIAT_CH0004188)

Predicted SEED Role

"Porphobilinogen deaminase (EC 2.5.1.61)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 2.5.1.61)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (30/33 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• tetrapyrrole biosynthesis II (from glycine) (4/4 steps found)
• superpathway of heme b biosynthesis from glutamate (8/10 steps found)
• tetrapyrrole biosynthesis I (from glutamate) (5/6 steps found)
• dipyrromethane cofactor biosynthesis (3/4 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (25/36 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.61

Protein Sequence (309 amino acids)

>ABIE40_RS18065 hydroxymethylbilane synthase (Rhizobium sp. OAE497)
MQTKPFRIGTRGSPLALAQAHEARDRLMAAHRLPEEMFEIVVLTTTGDRITDRSLAEIGG
KGLFTQELEEKLALGELDFAVHSAKDMPTVLPEGLYLSAYLPREDIRDAVVGRTAPKLID
LPHGATVGSSSLRRQALIRRMRPDINVITFRGLVDTRLRKLAEGQVDATLLALAGLKRLG
KVDVLTDILDPDTFPPAPAQGAIAIESRIGDERIDNLLAAINDPATFDAVSCERAFLGAL
DGSCRTPIGGYAICEGDQIKFSGLIITPDGRHQHAISIDGNRRDAAALGTRAGQDVRARA
GTTFFDDWS