Protein Info for ABIE40_RS17910 in Rhizobium sp. OAE497

Annotation: F0F1 ATP synthase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 490 TIGR01039: ATP synthase F1, beta subunit" amino acids 23 to 486 (464 residues), 835.1 bits, see alignment E=7.4e-256 PF02874: ATP-synt_ab_N" amino acids 26 to 92 (67 residues), 72.8 bits, see alignment E=2.8e-24 PF00006: ATP-synt_ab" amino acids 149 to 368 (220 residues), 235.2 bits, see alignment E=6.5e-74

Best Hits

Swiss-Prot: 97% identical to ATPB_RHIEC: ATP synthase subunit beta (atpD) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K02112, F-type H+-transporting ATPase subunit beta [EC: 3.6.3.14] (inferred from 91% identity to smk:Sinme_3087)

MetaCyc: 78% identical to ATP synthase subunit beta, mitochondrial (Homo sapiens)

Predicted SEED Role

"ATP synthase beta chain (EC 3.6.3.14)" in subsystem F0F1-type ATP synthase (EC 3.6.3.14)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (490 amino acids)

>ABIE40_RS17910 F0F1 ATP synthase subunit beta (Rhizobium sp. OAE497)
MARAATPKAAAKTAAKKTATGSVGKVTQVIGAVVDVAFEGELPAILNALETTNMGNRLVL
EVAQHLGENSVRTIAMDSTEGLVRGQEVTDTGAPISVPVGDETLGRIMNVIGEPVDEAGP
LVTASKRAIHQDAPAYVEQSTEAQILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIM
ELINNVAKAHGGYSVFAGVGERTREGNDLYHEMIESGVNKHGGGEGSKAALVYGQMNEPP
GARARVALTGLTVAEHFRDQGQDVLFFVDNIFRFTQAGSEVSALLGRIPSAVGYQPTLAT
DMGQMQERITTTTTGSITSVQAIYVPADDLTDPAPATSFAHLDATTVLSRSIAEKGIYPA
VDPLDSTSRMLDPMVVGEEHYEVARKVQSTLQRYKALQDIIAILGMDELSEEDRLAVARA
RKIERFLSQPFFVAEVFTGSPGKLVALEDTIKGFKGLVNGEYDHLPEAAFYMVGSMEEAI
EKAKKLSAAA