Protein Info for ABIE40_RS17140 in Rhizobium sp. OAE497

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 PF00005: ABC_tran" amino acids 18 to 159 (142 residues), 116.6 bits, see alignment E=3.5e-37 PF17912: OB_MalK" amino acids 233 to 283 (51 residues), 33.4 bits, see alignment 1.7e-11 PF08402: TOBE_2" amino acids 276 to 346 (71 residues), 45.2 bits, see alignment E=2e-15 PF03459: TOBE" amino acids 292 to 345 (54 residues), 29.8 bits, see alignment 1.4e-10

Best Hits

Swiss-Prot: 56% identical to AGLK_RHIME: Alpha-glucoside transport ATP-binding protein AglK (aglK) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 86% identity to rlg:Rleg_3776)

MetaCyc: 51% identical to polyol ABC-type transporterATP-binding component MtlK (Pseudomonas fluorescens)
7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]; 7.5.2.M2 [EC: 7.5.2.M2]

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.M2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>ABIE40_RS17140 ABC transporter ATP-binding protein (Rhizobium sp. OAE497)
MINLKNVRKFYGALEVIKGVDITVEDGEFAVFVGPSGCGKSTLLRMIAGLEGIDEGDLIL
NGQRINDVPPDKRGIAMVFQSYALYPHMTVAENIGFSLSLKKVPEAEIRKQVEGVAEILQ
LTDYLDRRPAALSGGQRQRVAIGRAIIKKPSLILFDEPLSNLDSALRVQMRAELQRLHRE
LKATVVYVTHDQVEAMTMADRIVVLNKGTVAQQGAPMSLYHQPENEFVATFIGSPKMNVI
PATATRQAGRIALDSPIGLRMDMPDAASVPQGEVRLGVRPEHLKIVGEGQGNFNAEVAIV
ERLGVETYITVGTTQDPIIVRADGDIAVRPGDRVSLAADPAACHLFDASGRVIRSANLS