Protein Info for ABIE40_RS17035 in Rhizobium sp. OAE497

Annotation: ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 444 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details PF08521: 2CSK_N" amino acids 19 to 150 (132 residues), 30.5 bits, see alignment E=5.3e-11 PF00512: HisKA" amino acids 229 to 293 (65 residues), 41.6 bits, see alignment E=1.5e-14 PF02518: HATPase_c" amino acids 339 to 443 (105 residues), 57 bits, see alignment E=3.7e-19

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 61% identity to ara:Arad_4023)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (444 amino acids)

>ABIE40_RS17035 ATP-binding protein (Rhizobium sp. OAE497)
MRREPSITRPLILALTSILVLFWLIAIGLSIRVMQHEFSEIFDSAQEETTQRLLALIVDD
LGERTVSDPRSIAMLNTAASREYLTYQLRDKTGKVVLRSNDAPSEPFSAPLTQGFHDTQS
HRIYTEATADGTLFMQVADRFGNRREAVRESAATLLWPLIVLIPASIFAVWFVVGRALKP
IETLRQDIATKDGGNMAPIESGRLPREIKPIARSVNLLLARLRAALEAEREFTANSAHEL
RTPIAGALAQTQRLAQELPAGPVRQRAQQVEASLTNLGRLAEKLLQLSRAEAGIGRSDTP
SDLKAILDMLMVDYARDSRTEGRVAYQAEPGAAMVRNADIDAFGIVIRNLVENALSHGDP
EQPVEVSIDGNGTIRVVNDSSVIAAADLANLKRRFRRGATNAPGSGLGLAIADRITTQMG
GTLELISPASGSRSGFEARVTLPA