Protein Info for ABIE40_RS16950 in Rhizobium sp. OAE497

Annotation: bifunctional helix-turn-helix domain-containing protein/methylated-DNA--[protein]-cysteine S-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 PF12833: HTH_18" amino acids 41 to 120 (80 residues), 66.5 bits, see alignment E=2.2e-22 TIGR00589: methylated-DNA--[protein]-cysteine S-methyltransferase" amino acids 207 to 285 (79 residues), 106.2 bits, see alignment E=3.4e-35 PF01035: DNA_binding_1" amino acids 208 to 287 (80 residues), 108.5 bits, see alignment E=1.2e-35

Best Hits

KEGG orthology group: K10778, AraC family transcriptional regulator, regulatory protein of adaptative response / methylated-DNA-[protein]-cysteine methyltransferase [EC: 2.1.1.63] (inferred from 89% identity to rlg:Rleg_3739)

Predicted SEED Role

"ADA regulatory protein / Methylated-DNA--protein-cysteine methyltransferase (EC 2.1.1.63)" in subsystem DNA repair, bacterial (EC 2.1.1.63)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.63

Use Curated BLAST to search for 2.1.1.63

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (290 amino acids)

>ABIE40_RS16950 bifunctional helix-turn-helix domain-containing protein/methylated-DNA--[protein]-cysteine S-methyltransferase (Rhizobium sp. OAE497)
MNMIANLNRDITPDGPDYETVRQVIELITEDYRDQPSLDDIAARLNQSPTQLQKTFTRWA
GLSPKAFLQAVTLDHAKRLLRQEELPLLETSFEVGLSGPSRLHDLFVTHEAMSPGEWKAR
GGGLTIRYGFHHSPFGVALVMATDRGLAGLAFSDLGDEAACFDDMACRWPNAEYVEDNQA
TAPYAERIFQPGKWSSEQPLRVVLIGTDFQVRVWESLLKIPFGKAVTYSDIANDIGNPKA
MRAVGAAVGANPISFVVPCHRALGKSGALTGYHWGLTRKRAMLGWESAHA