Protein Info for ABIE40_RS16785 in Rhizobium sp. OAE497

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 336 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 176 to 202 (27 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details amino acids 286 to 306 (21 residues), see Phobius details amino acids 312 to 331 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 51 to 326 (276 residues), 132.3 bits, see alignment E=9.3e-43

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 95% identity to rec:RHECIAT_CH0003916)

Predicted SEED Role

"Xylose ABC transporter, permease protein XylH" in subsystem Xylose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (336 amino acids)

>ABIE40_RS16785 ABC transporter permease (Rhizobium sp. OAE497)
MTTDINEETRQIRRRSWRDVDLRAVAPFAALILLLIVGALVNPNFIGITNLANVATRCAF
IAIIAVGATFVISAGDLDLSVGSMVAFVASLMILLLNSGVIADPTMMLVVAVVFAVVAGA
LCGLANGLITTVGKIEPFIATLGTMGIYRGLTTWLSQGGAITLRSPEIQTLYRPAYFGSI
LGVPVPIVVILAVTAVAAFILYRTRYGRHVVAVGSNSDVARYSGIAVNRVRTIAFVIQGL
CVAIAVLLYVPRLGSTSATTGILWELQAITAVVVGGTALKGGAGRVWGTICGAFILELVG
NIMLLSNFISEYLIGAIQGAIIIIAMLVQRSLVRKA