Protein Info for ABIE40_RS16100 in Rhizobium sp. OAE497

Annotation: helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 82 (23 residues), see Phobius details amino acids 94 to 110 (17 residues), see Phobius details amino acids 116 to 133 (18 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 185 to 206 (22 residues), see Phobius details PF12833: HTH_18" amino acids 257 to 336 (80 residues), 71.4 bits, see alignment E=6.6e-24

Best Hits

KEGG orthology group: None (inferred from 44% identity to rec:RHECIAT_CH0002740)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>ABIE40_RS16100 helix-turn-helix domain-containing protein (Rhizobium sp. OAE497)
MIFVPLPFVVALLLLILLVRMLRTEEWNAPGRRLFLALIAAYALQSVLIGFRWGYDTLAI
MPFQAVLAALVAPLSFASFADLTLETPRPLKRQWPHLLPAIGVALSFAFWRDIVGLSLIL
IFLGYGLSLLWISRSGADGLVASRLDGAFLSHRSLMVTAVALIASSLSDVFISLDFDNTG
GAHAGRIVALGNVIVLLILGSAAAAAGTSQPEQPATEAAPPPPSLPTEEDGAVAAHLDSL
METRQIYRGPELNLSRIARKLGLPARSVSTAVNRIHGMSVSQYVNEFRIRFACDQLVRTE
LPVTSVMFEAGFISKSNFNREFLRVTGASPTEYRRREQAGTVASPSRAPAFVSP