Protein Info for ABIE40_RS15795 in Rhizobium sp. OAE497

Annotation: phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 TIGR00872: 6-phosphogluconate dehydrogenase (decarboxylating)" amino acids 1 to 338 (338 residues), 417.4 bits, see alignment E=1.6e-129 PF03446: NAD_binding_2" amino acids 3 to 153 (151 residues), 121.1 bits, see alignment E=7.3e-39 PF00393: 6PGD" amino acids 185 to 213 (29 residues), 38.1 bits, see alignment (E = 1.9e-13) amino acids 233 to 333 (101 residues), 31.4 bits, see alignment E=2e-11

Best Hits

KEGG orthology group: K00033, 6-phosphogluconate dehydrogenase [EC: 1.1.1.44] (inferred from 88% identity to rlt:Rleg2_3229)

Predicted SEED Role

"6-phosphogluconate dehydrogenase, decarboxylating (EC 1.1.1.44)" in subsystem Pentose phosphate pathway (EC 1.1.1.44)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.44

Use Curated BLAST to search for 1.1.1.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>ABIE40_RS15795 phosphogluconate dehydrogenase (NAD(+)-dependent, decarboxylating) (Rhizobium sp. OAE497)
MQLGMVGLGRMGSYMVQRLMRDGHECVVYDAKAESVADLTGKGAVGSSSLEEFVSKLSRP
RAIWLMLPAAITDKVIAQLVPLLHDDDIIIDGGNSYYHDDIRRGAELITKGIHYVDVGTS
GGVFGLERGYCLMIGGEKGIVQSLSPIFASLAPGVGDVKPSENRTAAEHSTAEQGYLHCG
PHGAGHFVKMVHNGIEYGLMAAYAEGFNILKNANIGAATHEADAETAPLAHPEYYRYDFN
LQDVAEVWRRGSVITSWLLDLTSDALHADPALAKYAGRVSDSGEGRWTIMAAIDESVPTP
VLSAALYGRFSSRDQDEFANKVLSAMRAGFGGHVEKPKG