Protein Info for ABIE40_RS15520 in Rhizobium sp. OAE497

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 399 PF00733: Asn_synthase" amino acids 12 to 86 (75 residues), 26.3 bits, see alignment E=1.8e-09 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 14 to 376 (363 residues), 307.8 bits, see alignment E=4.1e-96 PF03054: tRNA_Me_trans" amino acids 14 to 216 (203 residues), 247.5 bits, see alignment E=3.1e-77 PF20259: tRNA_Me_trans_M" amino acids 231 to 285 (55 residues), 61.2 bits, see alignment 1.7e-20 PF20258: tRNA_Me_trans_C" amino acids 293 to 376 (84 residues), 39.2 bits, see alignment E=2.2e-13

Best Hits

Swiss-Prot: 93% identical to MNMA_AGRRK: tRNA-specific 2-thiouridylase MnmA (mnmA) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 93% identity to rec:RHECIAT_CH0003690)

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (399 amino acids)

>ABIE40_RS15520 tRNA 2-thiouridine(34) synthase MnmA (Rhizobium sp. OAE497)
MNTLDFDKKPEDTRVVVAMSGGVDSSVVAGILKHQGYDVLGITLQLYDHGAAVHRAGSCC
AGQDIDDARRVCETLGIPHYVLDYEKRFRDTVINPFMESYVAGETPIPCVSCNQTVKFAD
LLETAKELGADALATGHYIRSRPNPAPGNPGRRALYRPADADRDQSYFLFATTQEQIDYL
RFPLGGLPKAETRKLAEEMGLVVAKKADSQDICFVPQGKYSDVINKLKPNAALAGEIVHL
DGRVLGQHDGILHYTIGQRRGIGVATGEPLYVVYLDARSRRVIVGPKEALETHRVYLRDV
NWLGDEDLIHAASGEGFACYAKVRSTRIPEPAVLRADASGIYVDLTVGEAGIAPGQACAL
YSAPGDDARVFGGGFIERSEREPAAEASLKALLSQPVAA