Protein Info for ABIE40_RS15270 in Rhizobium sp. OAE497

Annotation: sugar ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 68 to 92 (25 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 151 to 176 (26 residues), see Phobius details amino acids 197 to 221 (25 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details PF00528: BPD_transp_1" amino acids 80 to 283 (204 residues), 69.8 bits, see alignment E=1.3e-23

Best Hits

Swiss-Prot: 34% identical to AMYD_BACSU: Putative ABC transporter permease protein AmyD (amyD) from Bacillus subtilis (strain 168)

KEGG orthology group: K10118, multiple sugar transport system permease protein (inferred from 88% identity to ara:Arad_4466)

Predicted SEED Role

"Predicted rhamnose oligosaccharide ABC transport system, permease component" in subsystem L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>ABIE40_RS15270 sugar ABC transporter permease (Rhizobium sp. OAE497)
MVARKSPYPYWFVLPAAVVFTTLFLAPTIASFWFSLTRWDLFTTQFIGLENYKQFFREPF
LIKGLINTVIYAVTTSAAKTVLGLLLAVLLTSGIWAQGALRTIIFFPVLVSTIGVGITFS
VLMHPTRGLINVALATLGIHGPGWLTDPALALYSIVVVDVWKGVGLATVIYIAGLASISP
DYYEAARIDGATRRQMFFRVTVPLSKPATVTVVTLSLIGGLRSFDLIWAMTKGGPGFSSD
VLASVIYKQYQAGFYGLSTAGNVILFLLIGLIVLPLTAWFNRKEIDL