Protein Info for ABIE40_RS15075 in Rhizobium sp. OAE497

Annotation: FMN reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03566: FMN reductase
  • amino acids 4 to 175 (172 residues), 249.8 bits, E=6.5e-79
• PF03358: FMN_red
  • amino acids 4 to 147 (144 residues), 103.7 bits, E=7.4e-34
• PF02525: Flavodoxin_2
  • amino acids 11 to 133 (123 residues), 30.5 bits, E=2.9e-11

Best Hits

Swiss-Prot: 39% identical to SFNE_PSEPU: NADH-dependent FMN reductase SfnE (sfnE) from Pseudomonas putida

KEGG orthology group: K00299, FMN reductase [EC: 1.5.1.29] (inferred from 78% identity to rle:pRL100232)

Predicted SEED Role

"FMN reductase (EC 1.5.1.29)" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization (EC 1.5.1.29)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (30/33 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (3/3 steps found)
• two-component alkanesulfonate monooxygenase (2/2 steps found)
• bacterial bioluminescence (4/8 steps found)
• dibenzothiophene desulfurization (1/5 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.5.1.29

Protein Sequence (185 amino acids)

>ABIE40_RS15075 FMN reductase (Rhizobium sp. OAE497)
MPLRLVGIAGSFNRPSKTHALVSHVADLASRRYGFSSKVYDLHDVGPSLGSSLWRKELDA
QAAGVIDDIVNADVLVVGSPTYKGSYPGHFKHLIDLIEPHELRAKPIIITATGGGDRHAL
MVEHQLRPLFGFFMAHTLPTAIYAADRDFADYKVTSEQLSGRIGFAIDELAAFFPSQHSS
LQAAE