Protein Info for ABIE40_RS14975 in Rhizobium sp. OAE497

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 359 signal peptide" amino acids 1 to 19 (19 residues), see Phobius details transmembrane" amino acids 40 to 58 (19 residues), see Phobius details amino acids 78 to 102 (25 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 183 to 199 (17 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 273 to 293 (21 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 1 to 311 (311 residues), 108.1 bits, see alignment E=2.5e-35

Best Hits

KEGG orthology group: None (inferred from 56% identity to atu:Atu4056)

Predicted SEED Role

"STRUCTURAL ELEMENTS; Cell Exterior; surface polysaccharides/antigens"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (359 amino acids)

>ABIE40_RS14975 acyltransferase (Rhizobium sp. OAE497)
MRIVLISGIVFVHIPFDPANTPFNGNYGFFDWLRVFLSEALFRVGVPCLSAISGYLLFRG
GMEGFNYTKTVRTKAQTVFLPFLIWNTLFFIAVLAILAVGIGDGYVISPYQSSFRELLSQ
LFAAEAFPANIPLYFLRDLFVCILISPILAWLVRRAPLLTLSTLLLLALVPQLSLYIVIK
RSILFSFTFGIYASLYKLDIKALDRFAPLGVFLLFAFSALLATAIYATGPSMPDWVELSR
NALAIGGAAGFWMLSALLIKTSVGQRLSKTGSLSFWIFCAHYPLLILLFMVWGKTGVDFY
PLFFCGCLLVLFPLLALSNGLVRSNAPKLYAVLTGGRTKKGPHSPSCRDIPADFVPQQR