Protein Info for ABIE40_RS14580 in Rhizobium sp. OAE497

Annotation: fluoride efflux transporter CrcB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 143 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details amino acids 25 to 25 (1 residues), see Phobius details amino acids 28 to 28 (1 residues), see Phobius details transmembrane" amino acids 21 to 24 (4 residues), see Phobius details amino acids 26 to 27 (2 residues), see Phobius details amino acids 37 to 58 (22 residues), see Phobius details amino acids 70 to 89 (20 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details PF02537: CRCB" amino acids 7 to 120 (114 residues), 101.7 bits, see alignment E=1.3e-33 TIGR00494: protein CrcB" amino acids 7 to 124 (118 residues), 89.3 bits, see alignment E=1.1e-29

Best Hits

Swiss-Prot: 75% identical to CRCB_METRJ: Putative fluoride ion transporter CrcB (crcB) from Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831 / NBRC 15690 / NCIMB 10815 / 0-1)

KEGG orthology group: K06199, CrcB protein (inferred from 75% identity to mrd:Mrad2831_4479)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (143 amino acids)

>ABIE40_RS14580 fluoride efflux transporter CrcB (Rhizobium sp. OAE497)
MSLYTCLIIMAGGALGTLARYLISVLAAPISGNLPWGTIIINITGSFIIGLFGTLTLAHG
RFPVSENMRLFVMIGLCGGYTTFSSFSLQTLDLMRSGAVTRAGVNIAASVVLCVAAVSAG
HLIASYFNGGEKQVAQLRVEEEV