Protein Info for ABIE40_RS14435 in Rhizobium sp. OAE497

Annotation: heme ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF00005: ABC_tran" amino acids 18 to 169 (152 residues), 82.3 bits, see alignment E=5.3e-27 PF00004: AAA" amino acids 32 to 83 (52 residues), 21.3 bits, see alignment E=3.2e-08

Best Hits

Swiss-Prot: 81% identical to HMUV_RHIL3: Hemin import ATP-binding protein HmuV (hmuV) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 81% identity to rle:RL3700)

Predicted SEED Role

"ABC-type hemin transport system, ATPase component" in subsystem Hemin transport system

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ABIE40_RS14435 heme ABC transporter ATP-binding protein (Rhizobium sp. OAE497)
MIELSNVSVDLSGKTVVHGVSFAARAGELTAIAGPNGSGKTTTMKAVSGELAARGSVKIN
GAEVRDMAPWKLAAIRGVLPQASAISFPFTVREIVRMGLTTGVNLHPEKAEETAARALGA
VDLHGFEGRYYQELSGGEEQRVQLARVLCQIAEPVAHGKPCWLLLDEPVSSLDISHQLTI
MRLARQFCEAGGGVIAVMHDLNLTALFADQIVLMKSGRLAAAGNVRDVLTDDNMHSVFGC
ALRINRVPADGTPFVLAHSAL