Protein Info for ABIE40_RS13900 in Rhizobium sp. OAE497

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 transmembrane" amino acids 29 to 51 (23 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 142 to 164 (23 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 255 to 278 (24 residues), see Phobius details amino acids 285 to 303 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 34 to 302 (269 residues), 87.5 bits, see alignment E=1.3e-28 PF00005: ABC_tran" amino acids 367 to 515 (149 residues), 112.8 bits, see alignment E=2e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 90% identity to rle:pRL110060)

Predicted SEED Role

"Transport ATP-binding protein CydCD" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (596 amino acids)

>ABIE40_RS13900 ABC transporter ATP-binding protein (Rhizobium sp. OAE497)
MTRKKLDFRADAYRNVLGFVFRQWTHRPALVGSIILLVIASTLAEVLVPVFSGRIVDAIA
GGNAADGAIRAFVVVAALGLTSVVLRWFIFNGIIRLTLRIMADVANSGFHKVQRFSTDWH
ANSFAGSTVRKITRGMWALDALNDLLLVALLPSVVMLAGASIVLGSYWPVMGLIVAAGSL
IYIGVTVVLSMGYVSPAAKLANAWDTKLGGALADAISCNSVVKAFGAEDREEERLSHVLA
KWDSRTRRTWRRGTLNGTIQGFMMVSMQAGILGTGLIMWQKGLATPGDITFVLAMFFVLQ
GYLRSVGQDIRNLQRAVNDMEELVLLDKTPLGIEDRPGAKAIAIGKGEIIFDRVTFQYGA
HPTPLYDDFSVAIKPGERVGLVGHSGSGKTTFVKLIQRLYDVNSGSIRIDGQDIAKVTQS
SLRGQIAIVQQEPILFHRTLAENIAYGRPEASRREIEDAARQASAHHFIMSLPKGYETMV
GERGVKLSGGERQRVAIARAFLADAPVLILDEATSSLDSESEVQIQQAMERLMEGRTTLV
IAHRLSTVRALDRLLVFDKGRIVEEGDHPSLVRLNNGIYRRLFERQALELTKGLVA