Protein Info for ABIE40_RS13750 in Rhizobium sp. OAE497

Annotation: xanthine dehydrogenase accessory protein XdhC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 268 transmembrane" amino acids 247 to 264 (18 residues), see Phobius details PF02625: XdhC_CoxI" amino acids 14 to 70 (57 residues), 49.5 bits, see alignment E=3.3e-17 TIGR02964: xanthine dehydrogenase accessory protein XdhC" amino acids 15 to 257 (243 residues), 295.7 bits, see alignment E=1.4e-92 PF13478: XdhC_C" amino acids 115 to 256 (142 residues), 100.7 bits, see alignment E=8.5e-33

Best Hits

KEGG orthology group: K07402, xanthine dehydrogenase accessory factor (inferred from 75% identity to rlg:Rleg_3136)

Predicted SEED Role

"XdhC protein (assists in molybdopterin insertion into xanthine dehydrogenase)" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (268 amino acids)

>ABIE40_RS13750 xanthine dehydrogenase accessory protein XdhC (Rhizobium sp. OAE497)
MTDFHTFLTTHPATILIEITGTQGSTPRETGTFMLVSPTTIWGTIGGGQFEYLAIENARN
LLENAGTETMDIPLGPEIGQCCGGRTQLRFRKVTDDVLNELEARHIGEAEHRPAVYLFGA
GHVGRALAVALAPLPLAVTVIETRQEELANLPAETATKLTAMPEALIAEIPSGSAIAILT
HDHSLDFLIAREALARTDLAYTGMIGSATKRATFSSWLSREGGEKASLARLTLPIGGSAV
RDKRPEVIAAMTAAEILAALAAYGQRSK