Protein Info for ABIE40_RS13500 in Rhizobium sp. OAE497

Annotation: choline ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 33 to 67 (35 residues), see Phobius details amino acids 70 to 90 (21 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 140 to 167 (28 residues), see Phobius details amino acids 212 to 240 (29 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details TIGR03416: choline ABC transporter, permease protein" amino acids 7 to 272 (266 residues), 438.4 bits, see alignment E=5.1e-136 PF00528: BPD_transp_1" amino acids 111 to 273 (163 residues), 93.3 bits, see alignment E=7.9e-31

Best Hits

Swiss-Prot: 46% identical to GBUB_LISM4: Glycine betaine/carnitine transport permease protein GbuB (gbuB) from Listeria monocytogenes serotype 1/2a (strain 10403S)

KEGG orthology group: K02001, glycine betaine/proline transport system permease protein (inferred from 88% identity to rec:RHECIAT_CH0003244)

Predicted SEED Role

"L-proline glycine betaine ABC transport system permease protein ProW (TC 3.A.1.12.1)" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>ABIE40_RS13500 choline ABC transporter permease subunit (Rhizobium sp. OAE497)
MNWITDFKIPIGAWAKSFVDWLTTNADWFFNQLAFILSHVIDGMLFVLQAPHPLIVILAI
AGIAYWIRRSVIVAVFTCLGLLLIANQGYWKETTETLALVLASTFVSMLVGIPLGIAAAR
RAWVYSVLRPILDLMQTIPTFVYLIPALILFGLGMVPGLIATVIFAIPAPIRLTRLGIIS
TPPSLVEAAESFGATPMQVLRKVELPFATPQIMAGLTQTIMLSLSMVVIAALVGADGLGV
PVVRALNTVNVAKGFEAGLCIVILAIILDRMFRVTGEGDGA