Protein Info for ABIE40_RS13135 in Rhizobium sp. OAE497

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 633 transmembrane" amino acids 44 to 65 (22 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 276 to 297 (22 residues), see Phobius details amino acids 301 to 301 (1 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details PF00664: ABC_membrane" amino acids 46 to 311 (266 residues), 36.2 bits, see alignment E=5.5e-13 PF00005: ABC_tran" amino acids 387 to 540 (154 residues), 111.9 bits, see alignment E=4e-36

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 86% identity to ret:RHE_CH03040)

Predicted SEED Role

"ATP-binding protein of ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (633 amino acids)

>ABIE40_RS13135 ABC transporter ATP-binding protein (Rhizobium sp. OAE497)
MFLRPILSLFENWVDPFRPRDKIQPPRSTLGFIWFYIGQARWPFVAMLILGGISAAIEAA
LFWFVGRLVDILSTIKPGVGWSGLLADHGGEIFGMLALIGIVRFVVAFLTALVDQQVITP
GFYNLARWQSYLHVSRQSLHFFQSDFSGRIVTKVWSAGQAVGDLVTSLMESVWFVGIYAA
TTLFLVARLDFSLAAVVLFWLIAFGVLARYFVPRIRYHSRETAEAASMLNGRMVDSYSNI
QTLKLFARDEESDRYMRQGFDMYQETVLRFTRFITGVRASMALLSGLMIVTMAGLSVDLW
LRGLVSSGAVAFSLALVLRLNFLLGRLMTQFNGIMRNLGTIQNAAELISQPLGLVDKPDA
KELVIREPSIRFENVSFHYGKGKGVIDNFSLTIAPGEKVGIVGRSGAGKSTLVSLLLRMY
DVEGGRILVDGQDISAVRQETLRMQIGVVSQDTSLLHRSVRDNILFGRPDAGEGKLIEAA
NRAEAMGFIDRLQDQNGRKGFDAHVGERGVKLSGGQRQRIVIARVMLKDAPILVLDEATS
ALDSEVEEAIQSNLNRIMDGKTVLAIAHRLSTIAALDRLIVVDQGKIIEEGTHEALIARG
GLYAELWARQSGGFLASDDGDAGAQSGREASVV