Protein Info for ABIE40_RS12920 in Rhizobium sp. OAE497

Annotation: calcium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 57 (21 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 105 to 126 (22 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 285 to 308 (24 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details PF01699: Na_Ca_ex" amino acids 39 to 187 (149 residues), 45.7 bits, see alignment E=3.4e-16 amino acids 220 to 361 (142 residues), 29 bits, see alignment E=4.7e-11

Best Hits

KEGG orthology group: K07300, Ca2+:H+ antiporter (inferred from 88% identity to rlt:Rleg2_2731)

Predicted SEED Role

"Calcium/proton antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>ABIE40_RS12920 calcium:proton antiporter (Rhizobium sp. OAE497)
MTLAARLRDEKFLVVAVIVAAVAYGLEHSILEMGRGAALIAAAALVGTIVLASIRVAHHA
EILAIKVGDPYGTMILTLSAVLVEVIILAIMMSGESSPTLVRDTIYSALMLDINGILGLA
ALLGGLKHGEQPYNDNSGKTYGVMILTAIGISMIVPEFVPDDKWHYYSGFTIIAMIALYG
LFLRMQVGQHSYFFSYSYPRAERKGNAPDEHHTDEPASASIITILIGVVIIGALAEFMSA
FMTEGLRDTGAPIALTAIVVAAISAAPEILTALRAALKNRMQATVNIAMGASLSTVILTV
PVMEAIALYTGQPFVMAMTPVQTVMVAITLIAAAINLNDGETNAIEGMTHFILFATFLML
SALGL