Protein Info for ABIE40_RS11345 in Rhizobium sp. OAE497
Annotation: PLP-dependent aminotransferase family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: None (inferred from 87% identity to rec:RHECIAT_CH0002872)Predicted SEED Role
"Aromatic-amino-acid aminotransferase (EC 2.6.1.57)" in subsystem Homogentisate pathway of aromatic compound degradation (EC 2.6.1.57)
MetaCyc Pathways
- superpathway of aromatic amino acid biosynthesis (18/18 steps found)
- superpathway of L-phenylalanine biosynthesis (10/10 steps found)
- superpathway of L-tyrosine biosynthesis (10/10 steps found)
- L-phenylalanine biosynthesis I (3/3 steps found)
- L-tyrosine biosynthesis I (3/3 steps found)
- L-phenylalanine biosynthesis III (cytosolic, plants) (2/2 steps found)
- 3-(4-hydroxyphenyl)pyruvate biosynthesis (1/1 steps found)
- L-tyrosine degradation II (1/2 steps found)
- atromentin biosynthesis (1/2 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- L-phenylalanine degradation II (anaerobic) (1/3 steps found)
- L-tyrosine degradation IV (to 4-methylphenol) (1/3 steps found)
- 4-hydroxybenzoate biosynthesis I (eukaryotes) (1/5 steps found)
- L-phenylalanine degradation VI (reductive Stickland reaction) (1/5 steps found)
- L-tyrosine degradation I (1/5 steps found)
- L-tyrosine degradation V (reductive Stickland reaction) (1/5 steps found)
- superpathway of plastoquinol biosynthesis (1/5 steps found)
- L-phenylalanine degradation IV (mammalian, via side chain) (2/9 steps found)
- rosmarinic acid biosynthesis I (2/10 steps found)
- superpathway of chorismate metabolism (37/59 steps found)
- (S)-reticuline biosynthesis I (1/11 steps found)
- tropane alkaloids biosynthesis (1/11 steps found)
- superpathway of rosmarinic acid biosynthesis (3/14 steps found)
- superpathway of hyoscyamine (atropine) and scopolamine biosynthesis (4/16 steps found)
- anaerobic aromatic compound degradation (Thauera aromatica) (1/27 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Alkaloid biosynthesis II
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of phenylpropanoids
- Lysine biosynthesis
- Methionine metabolism
- Novobiocin biosynthesis
- Phenylalanine metabolism
- Phenylalanine, tyrosine and tryptophan biosynthesis
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 2.6.1.57
Use Curated BLAST to search for 2.6.1.57
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (407 amino acids)
>ABIE40_RS11345 PLP-dependent aminotransferase family protein (Rhizobium sp. OAE497) MLNWDEMFATRASRMRASEIRELLKLLDQPDIISFAGGIPDPALFPDKEFKAAYAGIFDD GAVNSALQYSVSEGYKPLREWLVKQMAGLGIPCEAENVFIVSGSQQGLDYLGKLFLSPKD TALVTWPTYLGALQAFNAYEPSYDQLTPNGNRTPESYKAAATQNGGKVKFAYLSADFSNP TGETVDREGREKVLALAEDLDIAVIEDAAYQNLRYDGEAIPPILSLEIARKGHINDTRTI YCGSFSKTLAPGLRVGFIVANAPVIRKLVLMKQAADLHSSTINQIAIAEVAERGFDAQVA KIKAAYSHRRDAMLAALAKHMPDGVSWTKPEGGMFIWITLPEGMDGAALLAKSIETTRVA FVPGKAFFADGSGANTIRLSFSCANDQMIEEGIGRLGKLVAGEIGAL