Protein Info for ABIE40_RS11125 in Rhizobium sp. OAE497

Annotation: TSUP family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 48 to 66 (19 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 103 to 121 (19 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 189 to 215 (27 residues), see Phobius details amino acids 231 to 249 (19 residues), see Phobius details PF01925: TauE" amino acids 12 to 247 (236 residues), 177.6 bits, see alignment E=1.7e-56

Best Hits

Swiss-Prot: 74% identical to YCB9_SINSX: Probable membrane transporter protein ORF9 from Sinorhizobium sp.

KEGG orthology group: K07090, (no description) (inferred from 85% identity to rlt:Rleg2_2127)

Predicted SEED Role

"Putative membrane protein YfcA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (261 amino acids)

>ABIE40_RS11125 TSUP family transporter (Rhizobium sp. OAE497)
MSDIAPHLLALLCLAAFCAGFVDSIAGGGGLITVPAMLIAGIPPLQTLGTNKVQSMFGAA
SATLAYSRKGHVNLREQLPMAMMALMGGALGAALATIVPGDVLRAIMPVLLVAIALYFAF
KPNLNDLDTHRRITPYLFGMTFVPLIGFYDGVFGPGTGSFLMLSFVTLAGFGMLKATAHT
KLLNLGSNVGALIVFASFGATLWTVGLMMGVCQFLGAQVGSRLAMRTGAKLIKPLLVVVC
IAFAIKLIADPANPLRVWLGV