Protein Info for ABIE40_RS10465 in Rhizobium sp. OAE497

Annotation: PD40 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07676: PD40
  • amino acids 21 to 37 (17 residues), 11.8 bits, see alignment (E = 1.9e-05)
  • amino acids 105 to 137 (33 residues), 22.1 bits, 1.2e-08
  • amino acids 147 to 182 (36 residues), 30 bits, 3.7e-11

Best Hits

Swiss-Prot: 71% identical to Y1656_AGRFC: Uncharacterized protein Atu1656 (Atu1656) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 83% identity to ara:Arad_2675)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Protein Sequence (276 amino acids)

>ABIE40_RS10465 PD40 domain-containing protein (Rhizobium sp. OAE497)
MRSSVEIYNIRTAKSRVVFQTEQLIEAPNFSPDGRYLLLNGDGLLYRLSPDGEGGLRQVD
TGFAAACNNDHGISPDGRHYVISDKTEYGKSCIYTLSAEGGAPKQVTTNLPSYWHGWSPD
GKELAYCGIRDDVFDIYTIAVDGGAERRLTHGEGRNDGPDYSFDGQWIYFNSSRTGLMQI
WRIHPDGTGLEQVTHDNYGNWFAHPAPANDKVLILSYDPDVFDHPRDLHVRLRLMDMDGG
NLTTLFELFGGQGTINVPCWSPDGDEFAYVRYFPAT