Protein Info for ABIE40_RS10135 in Rhizobium sp. OAE497

Annotation: EAL domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 740 TIGR00229: PAS domain S-box protein" amino acids 11 to 140 (130 residues), 40.6 bits, see alignment E=2.5e-14 PF08447: PAS_3" amino acids 38 to 126 (89 residues), 74.3 bits, see alignment E=1.2e-24 amino acids 168 to 252 (85 residues), 49 bits, see alignment E=9.3e-17 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 288 to 451 (164 residues), 151.2 bits, see alignment E=2.2e-48 PF00990: GGDEF" amino acids 292 to 449 (158 residues), 152.9 bits, see alignment E=9.9e-49 PF00563: EAL" amino acids 469 to 701 (233 residues), 209 bits, see alignment E=1e-65

Best Hits

KEGG orthology group: None (inferred from 75% identity to rle:RL2605)

Predicted SEED Role

"Sensory box/GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (740 amino acids)

>ABIE40_RS10135 EAL domain-containing protein (Rhizobium sp. OAE497)
MEIHDTPDLAERESRWNYALIGSGLGVWDHNHRAGTKYYSETWKEIRGMGPDESADGDYE
EWLALLHPDDRDFVIEAIDKQIAGDPDYQVFEYRERHKDGHWVWIECRGACVEWDENGNP
ARIVGTDTDITARKRAEEMLEHLSRRLDLALDITRIGVFEADLEADAVEWDDRLLAMYGL
EGTSRVKPGEAWEKMLHPDDRVRALSRLDESLDKDQGLLHEFRIIRADGIERVIRARSAF
FVDAEGKRKLIGANWDVTEEVKLRNDLQNAKNLAEARNQELEAAKESIEHLALHDYLTGL
PNRRYLDRTLEERAEECRNGSLTLAVLHIDLDRFKQINDTLGHRAGDAMLKHAAKVLKDC
VRSTDFVARIGGDEFVVLCAIDSGTKKLSNMAARIIRELSKPIRYEGHECRFGASIGIAA
DSGADLDAKQLLLNADIALYRAKGAGRNRHEFFSKDARRSIIAAKRLADEILQGLERHEF
VPVYQLQFNARTLEVAGVETLARWQHPEHGLMAPDRFLKIAEDLDVVSTIDGLILEHALA
DRAAWAKQGFRTPKISVNVSSGRLNDPTLGKKLKALKVEPGTLSFELLESISLDDCDDAV
TANLRQIRRLGIDIEIDDFGTGHASIVSLLKLSPRTLKIDRELIRMLPQSAEQRKLVRSI
IDIGRSLNILVTAEGVETMDHVRILADLGCDVLQGYALARPMPAAQIPAYVQAANWRHPE
GGARALQSGLSREIKRNGTK