Protein Info for ABIE40_RS10095 in Rhizobium sp. OAE497

Annotation: flavin reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 PF01613: Flavin_Reduct" amino acids 16 to 164 (149 residues), 117.5 bits, see alignment E=2.8e-38

Best Hits

Swiss-Prot: 42% identical to RUTF_STAND: FMN reductase (NADH) RutF (rutF) from Starkeya novella (strain ATCC 8093 / DSM 506 / CCM 1077 / IAM 12100 / NBRC 12443 / NCIB 9113)

KEGG orthology group: K13786, cob(II)yrinic acid a,c-diamide reductase [EC: 1.16.8.1] (inferred from 77% identity to rlg:Rleg_2123)

MetaCyc: 54% identical to cob(II)yrinate a,c-diamide reductase monomer (Brucella melitensis)
Cob(I)yrinic acid a,c-diamide adenosyltransferase. [EC: 2.5.1.17]

Predicted SEED Role

"4-hydroxyphenylacetate 3-monooxygenase, reductase component (EC 1.6.8.-)" in subsystem 4-Hydroxyphenylacetic acid catabolic pathway or Aromatic Amin Catabolism (EC 1.6.8.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.8.-, 2.5.1.17

Use Curated BLAST to search for 1.16.8.1 or 1.6.8.- or 2.5.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>ABIE40_RS10095 flavin reductase (Rhizobium sp. OAE497)
MLSRQPIDPKLYRDAMSRFGGHVQLVTTALGDQVRGVTITAACSVSDSPACVLVCLNNSN
PKNEIFFRSGIFALNTLGAHHQGLADAFSGRTQLSNEERFATGKFEKLVTGAPVLSDSLA
SFDCRVMEIKEMSTHHVIFGEVVGVRFDETKPALLYMNRDYHTL