Protein Info for ABIE40_RS09795 in Rhizobium sp. OAE497

Annotation: heparan-alpha-glucosaminide N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 19 to 38 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 235 to 256 (22 residues), see Phobius details PF07786: HGSNAT_cat" amino acids 16 to 243 (228 residues), 227.3 bits, see alignment E=8.9e-72

Best Hits

KEGG orthology group: None (inferred from 62% identity to rlt:Rleg2_1864)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>ABIE40_RS09795 heparan-alpha-glucosaminide N-acetyltransferase (Rhizobium sp. OAE497)
MTVLATDSGVVARPPRIGLLDTVRGAALIAMATYHFSWDLEFMGYLTPGTAETGWLKLYA
RAIATTFLFIAGISMALSSQGGIRWRPFWKRFAMIAGAALLISVATRIAMPGEWIFFGIL
HCMAAMTLIGVVFVRLPLPVTLVVTVALVAAWIADTFVAPGILRSATFNHPLLWWIGLTD
MPPRSNDYVPLFPWAAAYMSGLSLSLIALRTSLPQKLAAIGTGSSLLARAGKHSLAFYLI
HQPVLIAIAYGLTFVMPPAKPDLAEIHMRQCNPGWCQGMDPKSCQIYCECTLTEMQDQKL
LEPFHTGVVKADDDRVQAIANQCSIKALPPEQQ