Protein Info for ABIE40_RS09785 in Rhizobium sp. OAE497

Annotation: L-serine ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 468 PF03315: SDH_beta" amino acids 4 to 162 (159 residues), 187 bits, see alignment E=2.8e-59 TIGR00720: L-serine ammonia-lyase" amino acids 4 to 465 (462 residues), 620 bits, see alignment E=1.3e-190 PF03313: SDH_alpha" amino acids 198 to 462 (265 residues), 304.8 bits, see alignment E=6.3e-95

Best Hits

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 92% identity to rec:RHECIAT_CH0002303)

Predicted SEED Role

"L-serine dehydratase (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (468 amino acids)

>ABIE40_RS09785 L-serine ammonia-lyase (Rhizobium sp. OAE497)
MFLSVFDVFKIGVGPSSSHTMGPMSAANRFLDLILSNEWPRPSSGAQVASIKASLHGSLA
YTGIGHGTGRAVILGLMGEAPDSVDPDKMDGIIDQVERSGRITPPGHPAYFFLPKNDLIF
DKKQTLPGHANGMIFSAFDKDDRLLLKRIYYSVGGGFVVTDTELEQMRAKKKAVAGATKV
PYPFATAAQMLEMADRSGLTIAQMKRANEESQRSREELDAGLDKIWEAMRSCIERGLKVD
GIMPGGLKVRRRARQIHDKLQEEWRSNRINPLLANDWLSVYAMAVNEENAAGGRVVTAPT
NGAAGVIPATIRYYEHFHDDWDQNGIRDYLLTAAAVGGIIKHNASISGAEVGCQGEVGSA
AAMAAAGLAAVMGATPAQIENAAEIALEHHLGMTCDPVAGLVQVPCIERNALGAVKAVTA
ASLAIKGDGQHFVPLDACIETMRQTGYDMSEKYKETSTGGLAVNVVEC