Protein Info for ABIE40_RS09615 in Rhizobium sp. OAE497

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 612 transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 154 to 178 (25 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 266 to 291 (26 residues), see Phobius details amino acids 298 to 319 (22 residues), see Phobius details PF00664: ABC_membrane" amino acids 112 to 305 (194 residues), 68 bits, see alignment E=1.7e-22 PF00005: ABC_tran" amino acids 377 to 531 (155 residues), 105.2 bits, see alignment E=6.8e-34

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 64% identity to ara:Arad_3241)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (612 amino acids)

>ABIE40_RS09615 ABC transporter ATP-binding protein (Rhizobium sp. OAE497)
MFRRFEELTDPFQSHADDTPPGRVWPFIFSTLKPLRGTVAASLALTAIGAVLEVWLIGYS
GRLVDTLAAIRPDELWERHGSELMFAAFLLLVVRPGTAVLNEGLDDIVFRPNAVAMIHWH
ALRHVKRQSVGWFQNDFSGRIAWRVQELGNSATGVAYSVIHTITYVAIYIAGSFLLMASV
DLRLVIPMLIWVALYFALMAYIIPRIREASQRFQEADSALSGMLVDTFSNIDTIKLFSRD
QDEDRDSRRHLDITRRAFIRSQVLEVTVNSSMVFLSSLLMVSLIGYSILLWQAGSAPLGM
VAAAIALGFRITAMAEWLLDAVASLFNHMGAARDQLSTIAQPVDIPDAPDAKELRLDGGT
LRFENVSHHYGKGQGGLDRVSLHVAAGEKVGLVGRSGAGKSTLVNLALRFFEAESGLITV
DGQDIRSVTQESLRGCFSMVAQNAALLHRSVRDNIAYGREDLPQAMIEAAAVKAHADGFI
PGLRDQQGRSGYDAHVGERGVKLSGGQRQRIALARAILKNAPILILDEATSALDSEVEAA
IQDTLYDFMEGKTVIAIAHRLSTIARMDRIVVLDRGRIAEEGRHQDLLARAGIYHRLWSR
QSGGFLGVDSGD