Protein Info for ABIE40_RS09415 in Rhizobium sp. OAE497

Annotation: pantetheine-phosphate adenylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01510: pantetheine-phosphate adenylyltransferase
  • amino acids 4 to 161 (158 residues), 183 bits, E=3.8e-58
• TIGR00125: cytidyltransferase-like domain
  • amino acids 4 to 57 (54 residues), 47.9 bits, E=1.2e-16
• PF01467: CTP_transf_like
  • amino acids 5 to 138 (134 residues), 66.4 bits, E=1.5e-22

Best Hits

Swiss-Prot: 88% identical to COAD_RHIEC: Phosphopantetheine adenylyltransferase (coaD) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00954, pantetheine-phosphate adenylyltransferase [EC: 2.7.7.3] (inferred from 88% identity to ret:RHE_CH02113)

MetaCyc: 41% identical to pantetheine-phosphate adenylyltransferase (Escherichia coli K-12 substr. MG1655)
Pantetheine-phosphate adenylyltransferase. [EC: 2.7.7.3]

Predicted SEED Role

"Phosphopantetheine adenylyltransferase (EC 2.7.7.3)" in subsystem Coenzyme A Biosynthesis (EC 2.7.7.3)

MetaCyc Pathways

• superpathway of coenzyme A biosynthesis I (bacteria) (8/9 steps found)
• superpathway of coenzyme A biosynthesis III (mammals) (5/5 steps found)
• coenzyme A biosynthesis I (bacteria) (4/4 steps found)
• coenzyme A biosynthesis II (eukaryotic) (4/4 steps found)
• coenzyme A biosynthesis III (archaea) (3/4 steps found)

KEGG Metabolic Maps

• Pantothenate and CoA biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.3

Protein Sequence (164 amino acids)

>ABIE40_RS09415 pantetheine-phosphate adenylyltransferase (Rhizobium sp. OAE497)
MTLAFYPGSFDPITNGHMDVLVQALNVAEKVIVAIGIHPGKAPLFSFEERADLIRQSLTE
ILPQRAAGIEVVSFDNLVVDAARKHKASLLIRGLRDGTDLDYEMQMAGMNRQMAPDIQTI
FLPAGTASRPITATLVRQIAAMGGDVSAFVPAAVLKALQSKRKS