Protein Info for ABIE40_RS09270 in Rhizobium sp. OAE497

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 166 to 187 (22 residues), see Phobius details amino acids 214 to 236 (23 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 301 to 322 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 312 (266 residues), 152.4 bits, see alignment E=6.8e-49

Best Hits

Swiss-Prot: 64% identical to YTFT_ECOLI: Inner membrane ABC transporter permease protein YtfT (ytfT) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 87% identity to rle:RL2378)

MetaCyc: 64% identical to galactofuranose ABC transporter putative membrane subunit YtfT (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YtfT"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>ABIE40_RS09270 ABC transporter permease (Rhizobium sp. OAE497)
MSSSLKALAIRLAPQLIALVVILSLNFIMFPQFFNVVVQNDRLYGSLIDVLNRGAPVALL
AIGMTLVIATKGIDLSVGAVIAICGAVAASSIVSGNSLAYTLVVTLAVGLLCGVWNGFLV
AILNIQPIIATLVLMVAGRGIAQLITEGVIMTFNDPGLIFFGSGSFAYLPMPVVIWLLVG
AIVILLVRRTALGMLVEAVGINRRASTLSGVRTPVLLMAVYMLSALCAAIAGIIVAADIK
GADANNAGLWLELDAILAVVVGGNSLLGGRFSILGSLIGAMIIQAVNTGILLSGFPPEFN
LIIKAIIILVILIIQSPALQSAAAFFSRKPAESAGVRVEQPK