Protein Info for ABIE40_RS08650 in Rhizobium sp. OAE497

Annotation: homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03447: NAD_binding_3
  • amino acids 11 to 127 (117 residues), 55.5 bits, E=1.4e-18
• PF00742: Homoserine_dh
  • amino acids 139 to 316 (178 residues), 218.1 bits, E=1.2e-68
• PF01842: ACT
  • amino acids 355 to 420 (66 residues), 30.8 bits, E=3e-11

Best Hits

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 90% identity to rlt:Rleg2_1545)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-isoleucine biosynthesis I (13/13 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• superpathway of L-threonine biosynthesis (6/6 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (10/12 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• L-homoserine biosynthesis (3/3 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (7/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (7/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (6/8 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Glycine, serine and threonine metabolism
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.3

Protein Sequence (440 amino acids)

>ABIE40_RS08650 homoserine dehydrogenase (Rhizobium sp. OAE497)
MADALKIGIAGLGTVGASLVRIIQQKSNELAATCGRPIHITAVTARDKNKDRGINLGGIT
WYDTPEELAAKADIDVFVELVGGSEGAAKASVKAALDRGLHVVTANKALLAYHGVEFAKI
AEEKGSLLNFEAAVAGGIPVIKALRESLTGNSISRIYGIMNGTCNYILTKMEKEGLSFAD
CLAEAQRLGYAEADPAFDIEGNDTAHKLSILTTLAFGNQIAADDIYLEGITNISIEDIRA
ASDLGYRIKLLGVAQRTDTGIEQRVHPTMVPVDSVIAQVDGVTNAVAIESDILGELLMVG
PGAGGNATASSVLGDIADIAKSQPGAQRVPVLGHPAKSLEPYRKAQMQSHEGGYFIRLTV
LDRTGVFASVATRMAENQISLESIVQRSQQHLSPSHHQTIILVTHATTEDSVRKAVAAIK
GEGYLVGEPQVIRIERPKED