Protein Info for ABIE40_RS08295 in Rhizobium sp. OAE497

Annotation: SDR family NAD(P)-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08659: KR
  • amino acids 11 to 171 (161 residues), 50.3 bits, E=6.8e-17
• PF00106: adh_short
  • amino acids 12 to 200 (189 residues), 175.9 bits, E=1.7e-55
• PF01370: Epimerase
  • amino acids 14 to 172 (159 residues), 28.6 bits, E=2.3e-10
• PF13561: adh_short_C2
  • amino acids 17 to 201 (185 residues), 132.7 bits, E=4.2e-42
• PF13460: NAD_binding_10
  • amino acids 17 to 148 (132 residues), 29.2 bits, E=2.1e-10

Best Hits

KEGG orthology group: None (inferred from 85% identity to rle:RL1981)

Predicted SEED Role

"Oxidoreductase, short-chain dehydrogenase/reductase family (EC 1.1.1.-)" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Protein Sequence (278 amino acids)

>ABIE40_RS08295 SDR family NAD(P)-dependent oxidoreductase (Rhizobium sp. OAE497)
MRDFIARPEHGIVWITGASSGIGRALALKLAGEGYKVAVTARDHEKLADLQAEVNGLSGS
IIVLDGDVTDPEDMEHAFASIEYEHGALAMAIFNAGVYLPVHAEDLNRDDFEKTFAVNLS
GVVNCLVPAVRHMKAKGQGQIAIVSSVTGYGGLPTSAAYGASKAALINMAESLKFDLDKM
GIRIQVICPGFVDTPATQKNEFPMPSLISVDEAASEIAAGLKSQSFEISFPKRFTYQLKL
LGMLPYSLYFWLLNRSTGWRERPLVKHGHHPATPHPAE