Protein Info for ABIE40_RS08230 in Rhizobium sp. OAE497

Annotation: FMN-dependent NADH-azoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF02525: Flavodoxin_2" amino acids 3 to 199 (197 residues), 168 bits, see alignment E=2.3e-53 PF03358: FMN_red" amino acids 4 to 173 (170 residues), 34.5 bits, see alignment E=1.5e-12

Best Hits

Swiss-Prot: 86% identical to AZOR_RHIL3: FMN-dependent NADH-azoreductase (azoR) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: K01118, FMN-dependent NADH-azoreductase [EC: 1.7.-.-] (inferred from 87% identity to rlg:Rleg_1603)

MetaCyc: 44% identical to FMN dependent NADH:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
RXN0-5375 [EC: 1.7.1.17]; 1.6.5.- [EC: 1.7.1.17]

Predicted SEED Role

"FMN-dependent NADH-azoreductase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.-.- or 1.7.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>ABIE40_RS08230 FMN-dependent NADH-azoreductase (Rhizobium sp. OAE497)
MSSILLLTSSPRAESLSTTIAADLANKIAAQNAGSVVVRRDLAANPLPHIDDLFTAAIRK
PADQRTAQEAEAVKTSDALVDELLAADTVVIGTGLINFNIYSSLKTWIDNVARAGRTFKY
TESGPVGLATGKKVYVVLASGGVYSQGPAAGMNHAVPYLKSVLGFLGIADVETIYVEGLA
FGPEAAEKAIGAAKARAEEIALAA