Protein Info for ABIE40_RS08040 in Rhizobium sp. OAE497

Annotation: DegQ family serine endoprotease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR02037: peptidase Do" amino acids 41 to 465 (425 residues), 493.4 bits, see alignment E=3e-152 PF00089: Trypsin" amino acids 90 to 249 (160 residues), 75.9 bits, see alignment E=1.3e-24 PF13365: Trypsin_2" amino acids 93 to 228 (136 residues), 124.2 bits, see alignment E=2.2e-39 PF13180: PDZ_2" amino acids 271 to 359 (89 residues), 42.3 bits, see alignment E=2.3e-14 amino acids 399 to 458 (60 residues), 36.4 bits, see alignment E=1.6e-12 PF00595: PDZ" amino acids 290 to 346 (57 residues), 26 bits, see alignment 3e-09 amino acids 401 to 441 (41 residues), 25.5 bits, see alignment 4.1e-09 PF17820: PDZ_6" amino acids 295 to 333 (39 residues), 37 bits, see alignment 7e-13 amino acids 405 to 445 (41 residues), 39.7 bits, see alignment 1e-13

Best Hits

KEGG orthology group: None (inferred from 88% identity to rlg:Rleg_1463)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (467 amino acids)

>ABIE40_RS08040 DegQ family serine endoprotease (Rhizobium sp. OAE497)
MQGLLKRSFVPLFALAVLLPLGAHAEDAKTVPQSQMQMQLSFAPLVKQTSGAVVNVYAEK
TVQRQSPFAGDPFFEQFFGQQMPNRSEKQSSLGSGVIVEANGTVVTNNHVIEGADDIKVA
LSDGREFPCKVVLRDDRLDLAVLKIDTKANFPTLPIGNSDAVEVGDLVLAIGNPFGVGQT
VTSGIVSALARNQVVKNEFGFFIQTDASINPGNSGGALMNMKGELIGINTAIFSRGGGSN
GIGFAIPANLVKVFLTSADAGVKSFERPYVGATFDAVTSEVAEALGLDKARGALIVKVTD
GSPAQKAGLKAGEIVTSVNGIPVEHPDALLYRLTTAGLGNTVKLGVVENGGEQQVALKLD
RAPETSPRDQRTIGGRTPFTGTVVENLSPRVADELRMPTESTGVVVAEVKDDSPAARLGF
EPKDIIVAINGTPVQTTEQLSQIASDDAGLWRVEIERDGQRIRQFFR