Protein Info for ABIE40_RS07985 in Rhizobium sp. OAE497

Annotation: DUF817 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 281 transmembrane" amino acids 39 to 58 (20 residues), see Phobius details amino acids 64 to 82 (19 residues), see Phobius details amino acids 91 to 109 (19 residues), see Phobius details amino acids 125 to 146 (22 residues), see Phobius details amino acids 158 to 176 (19 residues), see Phobius details amino acids 182 to 201 (20 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 246 to 268 (23 residues), see Phobius details PF05675: DUF817" amino acids 28 to 264 (237 residues), 318.5 bits, see alignment E=1.5e-99

Best Hits

KEGG orthology group: None (inferred from 75% identity to atu:Atu1921)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (281 amino acids)

>ABIE40_RS07985 DUF817 domain-containing protein (Rhizobium sp. OAE497)
MLLPALDEHLTAIPEAQGLRGIRRFAVEFLYFGIKEARASLFAGLFFLAVFAVPRAGLFG
LARYDLLLVIAMAIQAAMVLAKLETLDELKAITLFHLIGFALEVFKTSSSIQSWSYPDFG
YTKLFGVPLFSGFMYAAIGSYVIQAWRVLDLRVRHHPPYWMATLAATAIYANFYTHHYIG
DYRWYIAACTLGLYARTTVIFRPYDRDRRMPLLIAFVLIGFFIWLAENVHSFLGLWQYPN
QIGGWSVVHIGIWSSWSLVVVMTFTIVANLKHIKERIHVPE