Protein Info for ABIE40_RS07860 in Rhizobium sp. OAE497
Annotation: 50S ribosomal protein L4
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 96% identical to RL4_RHILW: 50S ribosomal protein L4 (rplD) from Rhizobium leguminosarum bv. trifolii (strain WSM2304)
KEGG orthology group: K02926, large subunit ribosomal protein L4 (inferred from 95% identity to ret:RHE_CH01676)MetaCyc: 34% identical to 50S ribosomal subunit protein L4 (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"LSU ribosomal protein L4p (L1e)" in subsystem Ribosome LSU bacterial
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (206 amino acids)
>ABIE40_RS07860 50S ribosomal protein L4 (Rhizobium sp. OAE497) MEFNVKTLEGKDAGKVSLSDAIFGLEPREDILARVIRWQLAKKQQGTHQAKGRADVSRTG AKMYKQKGTGRARHHSARAPQFRGGGKAHGPVARSHEHDLPKKVRALGLRLALSAKLKSD DVIIIDNLVAAEAKTKALAATFETLGLTNALFIGGAELDGNFKLAAQNIPNIDVLPIQGI NVYDIVRRGKLVLSKAAVEALEERFK