Protein Info for ABIE40_RS07385 in Rhizobium sp. OAE497

Annotation: aspartate carbamoyltransferase catalytic subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00670: aspartate carbamoyltransferase
  • amino acids 7 to 304 (298 residues), 316.6 bits, E=7.6e-99
• PF02729: OTCace_N
  • amino acids 7 to 149 (143 residues), 149.6 bits, E=7e-48
• PF00185: OTCace
  • amino acids 159 to 302 (144 residues), 98.5 bits, E=4.3e-32

Best Hits

Swiss-Prot: 100% identical to PYRB_AGRRK: Aspartate carbamoyltransferase (pyrB) from Agrobacterium radiobacter (strain K84 / ATCC BAA-868)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 99% identity to rlt:Rleg2_1299)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (17/18 steps found)
• UMP biosynthesis II (6/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• UMP biosynthesis I (5/6 steps found)
• UMP biosynthesis III (5/6 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Protein Sequence (318 amino acids)

>ABIE40_RS07385 aspartate carbamoyltransferase catalytic subunit (Rhizobium sp. OAE497)
MVFFPHRHLIGIKGLTEQDITYLLDKADEAVKISRQREKKTSTLRGLTQINLFFEASTRT
QASFELAGKRLGADVMNMSVGNSSVKKGETLIDTAMTLNAMRPDVLVIRHSSAGAAALLA
QKVSCSVVNAGDGQHEHPTQALLDALTIRRAKGKLSRIIVAICGDVLHSRVARSNILLLN
AMGARVRVVAPATLLPAGIADMGVEVFHSMKEGLKDADVVMMLRLQRERMSGAFVPSVRE
YYHFYGLDAETLKAAKEDALVMHPGPMNRGVEIASEVADGPQSVIAEQVEMGVAVRMAVM
ETLLVSQNQGPRTEGVGA