Protein Info for ABIE40_RS07180 in Rhizobium sp. OAE497

Annotation: NADH-quinone oxidoreductase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 47 to 188 (142 residues), 240.8 bits, E=2.1e-76
• PF01058: Oxidored_q6
  • amino acids 73 to 180 (108 residues), 100.8 bits, E=2.4e-33

Best Hits

Swiss-Prot: 97% identical to NUOB1_RHIEC: NADH-quinone oxidoreductase subunit B 1 (nuoB1) from Rhizobium etli (strain CFN 42 / ATCC 51251)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 95% identity to rlg:Rleg_1352)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• NADH to cytochrome bd oxidase electron transfer I (2/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Protein Sequence (194 amino acids)

>ABIE40_RS07180 NADH-quinone oxidoreductase subunit B (Rhizobium sp. OAE497)
MGVTPAGNQPLVSQAPKGIIDPSTGKPIGANDAFFGEINNELADKGFLVTSTDELINWAR
TGSLMWMTFGLACCAVEMMQLSMPRYDVERFGFAPRASPRQSDVMIVAGTLTNKMAPALR
KVYDQMPEPRYVISMGSCANGGGYYHYSYSVVRGCDRVVPIDIYVPGCPPTAEALLYGVL
LLQKKIRRTGTIER