Protein Info for ABIE40_RS06635 in Rhizobium sp. OAE497

Annotation: adenylate/guanylate cyclase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 35 to 51 (17 residues), see Phobius details amino acids 72 to 96 (25 residues), see Phobius details amino acids 111 to 131 (21 residues), see Phobius details PF00211: Guanylate_cyc" amino acids 160 to 329 (170 residues), 46.9 bits, see alignment E=1.3e-16

Best Hits

Swiss-Prot: 58% identical to CYA2_RHIME: Adenylate cyclase 2 (cya2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01768, adenylate cyclase [EC: 4.6.1.1] (inferred from 68% identity to ret:RHE_CH01494)

Predicted SEED Role

"Adenylate cyclase (EC 4.6.1.1)" in subsystem cAMP signaling in bacteria (EC 4.6.1.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.6.1.1

Use Curated BLAST to search for 4.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>ABIE40_RS06635 adenylate/guanylate cyclase domain-containing protein (Rhizobium sp. OAE497)
MREISPVQNWLLLTLVMAGSGVLYDVLFYGDSRPFIGATFALFIGMPILAFERKAILRGL
SRRIQKLPTFTYFLAQLFIYEVLMSAGFAVAGVLLRAVGAIQPTSWIEATILPFNVFMYA
LVVCAAIIFVVRVRELLGRDVFLAMLTSRYRNPVSEERIFLFVDLVDSTPFAEKHGDLRA
QQMLNSLFAAFAEPVRRNRGTIDDYVGDSAIITWPLARGMKNGRCVRCVFDILNAIEKEA
PSWLKQYGQVPRLRAALHGGFVITAEIGVDHHKITYFGDTVNTTSRLESLCKTLNRPILI
SSELANRMTLPDFVNAEDLGMHALKGRGQGLGVMALAQAIPASAQSPKLHSTVNSAT