Protein Info for ABIE40_RS06335 in Rhizobium sp. OAE497

Annotation: DUF2232 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 327 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 35 to 39 (5 residues), see Phobius details amino acids 41 to 90 (50 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 175 to 199 (25 residues), see Phobius details amino acids 225 to 268 (44 residues), see Phobius details amino acids 280 to 302 (23 residues), see Phobius details PF09991: DUF2232" amino acids 19 to 305 (287 residues), 44.1 bits, see alignment E=8.1e-16

Best Hits

KEGG orthology group: None (inferred from 79% identity to rlg:Rleg_1195)

Predicted SEED Role

"FIG003573: hypothetical protein" in subsystem CBSS-262719.3.peg.410

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (327 amino acids)

>ABIE40_RS06335 DUF2232 domain-containing protein (Rhizobium sp. OAE497)
MNKLDFKTLLTGALAGITAALLVLGASVQLSFSAVLYAASALPILLVGLGWGNAAAISAV
VTAAVLGAIAISPTFALMMTLVTLLPAGWLSHLANLARPASELGGPDHLMAWYPLSDILL
HLCALVTLAVIVTGFMIGYGPDLVSQMVDALFTSFAQQQPEVSLDPAATAQTKSLLLLML
PAIQGAMWVVLLFAAYYIATRIVNASGRALRPREDIPSALRMNRNSIFVFLAGLAATFFG
GVPAMIGATVVGTFGAGFLLSGFASLHFRTRGKDWRLPALILLYLASLILMLPAFFILVV
GLSDTRKAIALTPNKDADAPKQTDSNI