Protein Info for ABIE40_RS05865 in Rhizobium sp. OAE497

Annotation: glycosyltransferase family 39 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 63 to 92 (30 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 153 to 189 (37 residues), see Phobius details amino acids 198 to 218 (21 residues), see Phobius details amino acids 251 to 275 (25 residues), see Phobius details amino acids 289 to 309 (21 residues), see Phobius details amino acids 315 to 333 (19 residues), see Phobius details amino acids 345 to 370 (26 residues), see Phobius details PF13231: PMT_2" amino acids 55 to 216 (162 residues), 96.7 bits, see alignment E=9.1e-32

Best Hits

Swiss-Prot: 38% identical to RGTB_RHIL3: Lipopolysaccharide core galacturonosyltransferase RgtB (rgtB) from Rhizobium leguminosarum bv. viciae (strain 3841)

KEGG orthology group: None (inferred from 38% identity to rle:RL1468)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>ABIE40_RS05865 glycosyltransferase family 39 protein (Rhizobium sp. OAE497)
MVTYLRRNPDGVLWLLAVYLAVQAAFRIFVSNSLSVDESQQVFFGQWLSIGYNTQPPLYN
WLQYAVFAVFGISIASVAILKNIMLFISYLCYYRLSREVLKQQLFAVIATLGFFTIPQMF
WQAQKDLTHTVSLLIAITLSIHLTIRILKSPSTLSYVLLGFAVAAGMLSKYNFALVVLAI
LVAVLMHPEGLRRLLDKRFLLTIAISVVLFLPHGLWILRNPELASDATLSMMSADAVQSR
LAQILEGLKDLATTSFAIAAPTTLFLAIIFGRDFVAAFKARSDWSRFFTRFYATILAALL
VMILVMTLTEFRDRWLFPFLFLLPLLICLKLEAADVKAEDYFAKFLVLPIVMLCLLPFIL
TGGTMLAGVLGKYGNLNRPYARFVEAAIAKEGKQPSLIVTERWHDAGNVKLAEQAAPVIV
GNFPGYAPAATISSDHPALLIFNTERANTEPLSAQLQEWLSAHPELNQTPVKQTLDIRYL
YGKEDATYPFTYVWVYPAAP